McDonnell Genome Institute

Washington University

Transcript

MANCR:35

Chromosome

chr10

Gene Name

MANCR

Start

4579251

CPC Label

noncoding

End

4678070

Cancer

OV

Strand

-

Peptide

VLVLGLK

Modified Peptide

n[145]VLVLGLK

Peptide Length

7

ORF Length

66

Open Reading Frame (ORF)

LHKEFSFSCFNSHLTNVIILFQILFISFTVIPIGLVNNLTCVNHPQPLNKVLVLGLKKNFNQSINY

Conservation Score

0.563

PhyloCSF Frame 1

-5.257

No. of Spectra

2

CPC Coding Probability

0.0252139

PhyloCSF Frame 2 

-5.203

CNTI Index

noncoding

Max Probability

0.9916

PhyloCSF Frame 3

-5.616

CNTI Score

-0.420162405