McDonnell Genome Institute

Washington University

Transcript

MANCR:25

Chromosome

chr10

Gene Name

MANCR

Start

4631124

CPC Label

noncoding

End

4678214

Cancer

CCRC

Strand

-

Peptide

LSVSGCLSINLK

Modified Peptide

n[230]LSVSGCLSINLK

Peptide Length

12

ORF Length

56

Open Reading Frame (ORF)

LQKVKMSIYLWPRKKRKLSVSGCLSINLKSLCIYVNVKAKEEMCQTPWHQADHRIK

Conservation Score

0.009

PhyloCSF Frame 1

-4.766

No. of Spectra

1

CPC Coding Probability

0.0746807

PhyloCSF Frame 2 

-4.346

CNTI Index

noncoding

Max Probability

0.0736

PhyloCSF Frame 3

-4.731

CNTI Score

-0.379677224