McDonnell Genome Institute

Washington University

Transcript

MANCR:22

Chromosome

chr10

Gene Name

MANCR

Start

4581142

CPC Label

noncoding

End

4678222

Cancer

OV

Strand

-

Peptide

IFIPKEDFQK

Modified Peptide

n[145]IFIPKEDFQK

Peptide Length

10

ORF Length

69

Open Reading Frame (ORF)

LLSDLAYREELTQTSLDVLSSCHWCIPYQCESKILIKLSSIYARKIFIPKEDFQKMTHEGHSSQSSLLF

Conservation Score

0.342

PhyloCSF Frame 1

-3.81

No. of Spectra

3

CPC Coding Probability

0.0897275

PhyloCSF Frame 2 

-4.818

CNTI Index

coding

Max Probability

0.9875

PhyloCSF Frame 3

-4.737

CNTI Score

0.529455997