McDonnell Genome Institute

Washington University

Transcript

MAMDC2-AS1:19

Chromosome

chr9

Gene Name

MAMDC2-AS1

Start

70033920

CPC Label

noncoding

End

70088424

Cancer

OSCC

Strand

-

Peptide

VSFIFIGNK

Modified Peptide

n[145]VSFIFIGNK

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

LFCPGRVSFIFIGNKIITVRKAQTIGDNEETLLPDVAGCLNDLIQ

Conservation Score

0.999

PhyloCSF Frame 1

-4.197

No. of Spectra

2

CPC Coding Probability

0.0185506

PhyloCSF Frame 2 

-5.291

CNTI Index

noncoding

Max Probability

0.9254

PhyloCSF Frame 3

-5.732

CNTI Score

-0.407203493