McDonnell Genome Institute

Washington University

Transcript

MALINC1:40

Chromosome

chr5

Gene Name

MALINC1

Start

140101467

CPC Label

coding

End

140114769

Cancer

EOGC

Strand

-

Peptide

AGAVLPQVREGAGWR

Modified Peptide

n[145]AGAVLPQVREGAGWR

Peptide Length

15

ORF Length

318

Open Reading Frame (ORF)

LGALQPKFRFMADILVGCLPLQTSQPASGAHRRSQRRPLSFTSVPFALGQRQRSCGADPALWGSKNALFGPPIFGPGFICDVSTKGFFFFFPGFVLFLQRILGGCMHLVVVGWGEPNRGGVGSEAWVIELSFLSLLPGLPCRECQPRLAHSPRPQGEGGQGKWGSGIAKQTHHWWSPAPAEVGSPLFLRGVLFCSLLKVGGGSFVSRCGGWERTLLHRLGLQEGGCGDVCNGTIIIPGLREQVKGTGRASPGAVAVAAGKVARGLPGRAGAVLPQVREGAGWREGGRARDRREEGGRGGGRARAHLSWTAALAELRLT

Conservation Score

1

PhyloCSF Frame 1

3.444

No. of Spectra

3

CPC Coding Probability

0.988929

PhyloCSF Frame 2 

1.126

CNTI Index

coding

Max Probability

0.1154

PhyloCSF Frame 3

1.074

CNTI Score

0.689991029