McDonnell Genome Institute

Washington University

Transcript

MAGI2-AS3:11

Chromosome

chr7

Gene Name

MAGI2-AS3

Start

79453677

CPC Label

noncoding

End

79455051

Cancer

CRC

Strand

+

Peptide

RASPLPPSLPPQLDPVVK

Modified Peptide

Peptide Length

18

ORF Length

82

Open Reading Frame (ORF)

LQWQGACACVCVCVCVLVLLYWQTGGGRGGGARAPGGEPRRASPLPPSLPPQLDPVVKAEREAGWVRLAAYGRRREPGRRGA

Conservation Score

1

PhyloCSF Frame 1

1.404

No. of Spectra

1

CPC Coding Probability

0.0213012

PhyloCSF Frame 2 

-0.061

CNTI Index

noncoding

Max Probability

0.759

PhyloCSF Frame 3

1.528

CNTI Score

-0.327443674