McDonnell Genome Institute

Washington University

Transcript

MAGI1-IT1:2

Chromosome

chr3

Gene Name

MAGI1-IT1

Start

65951768

CPC Label

noncoding

End

65954554

Cancer

HCC

Strand

-

Peptide

SQAGEVK

Modified Peptide

n[230]SQAGEVK

Peptide Length

7

ORF Length

97

Open Reading Frame (ORF)

LICSVEERMWPCTPASLDTPVGLVSLLKPPCGALDTGAIGSALATVSTETGLGGTQVSVSFSCWLNPKYVCNRSQAGEVKLKPGLSLGLDSPVAYFR

Conservation Score

1

PhyloCSF Frame 1

-3.435

No. of Spectra

24

CPC Coding Probability

0.0789023

PhyloCSF Frame 2 

-3.889

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

-3.368

CNTI Score

-0.33137161