McDonnell Genome Institute

Washington University

Transcript

MAGI1-AS1:1

Chromosome

chr3

Gene Name

MAGI1-AS1

Start

65893815

CPC Label

noncoding

End

65925297

Cancer

OV

Strand

+

Peptide

LYHLSHEMAEEEK

Modified Peptide

n[145]LYHLSHEM[147]AEEEK

Peptide Length

13

ORF Length

92

Open Reading Frame (ORF)

LLSFTYAGLSQICLTTRSFDLPIKHFLSLGELKSCRAHHGIHCSMTTVSLPRLLPLLIQELRRLYHLSHEMAEEEKTRCLFKSPLDFHFFFH

Conservation Score

1

PhyloCSF Frame 1

-4.471

No. of Spectra

2

CPC Coding Probability

0.0145449

PhyloCSF Frame 2 

-2.9

CNTI Index

noncoding

Max Probability

0.5429

PhyloCSF Frame 3

0

CNTI Score

-0.432563496