McDonnell Genome Institute

Washington University

Transcript

MAFTRR:1

Chromosome

chr16

Gene Name

MAFTRR

Start

79714742

CPC Label

noncoding

End

79770930

Cancer

OV

Strand

-

Peptide

FAAPIGPAAAVAR

Modified Peptide

n[145]FAAPIGPAAAVAR

Peptide Length

13

ORF Length

124

Open Reading Frame (ORF)

LGCEGSLGLFSWLGQRTSPQPSFWSGAGRFAAPIGPAAAVARRMDQWRAKGVWAPPLLGRGWSPGSGGVRASPGGSFSSSFFFFFLRRGGAGGAASRSSGRWKVYLLGSSHLCGAPIALQRCAA

Conservation Score

1

PhyloCSF Frame 1

-2.856

No. of Spectra

7

CPC Coding Probability

0.0672748

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8854

PhyloCSF Frame 3

0

CNTI Score

-0.357636676