McDonnell Genome Institute

Washington University

Transcript

MAFA-AS1:1

Chromosome

chr8

Gene Name

MAFA-AS1

Start

143417663

CPC Label

noncoding

End

143419793

Cancer

OSCC

Strand

+

Peptide

LGGEGELQR

Modified Peptide

n[145]LGGEGELQR

Peptide Length

9

ORF Length

86

Open Reading Frame (ORF)

LLSFSFFSTNIDGAPPRCQALLQPLGNQPWKHTDPALPAPVFWWSGGEENQQEPAQESDGGSAERNKLGGEGELQRLHGCDGWSGS

Conservation Score

0.473

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0155468

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.316135776