McDonnell Genome Institute

Washington University

Transcript

LY86-AS1:12

Chromosome

chr6

Gene Name

LY86-AS1

Start

6346103

CPC Label

noncoding

End

6362467

Cancer

BRCA-Luminal B

Strand

-

Peptide

DVNIQEMR

Modified Peptide

n[145]DVNIQEMR

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC

Conservation Score

0.123

PhyloCSF Frame 1

-6.043

No. of Spectra

32

CPC Coding Probability

0.0855651

PhyloCSF Frame 2 

-6.675

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-5.768

CNTI Score

-0.330729493