McDonnell Genome Institute

Washington University

Transcript

LURAP1L-AS1:8

Chromosome

chr9

Gene Name

LURAP1L-AS1

Start

12753654

CPC Label

noncoding

End

12759814

Cancer

OV

Strand

-

Peptide

INICVFYDR

Modified Peptide

n[145]INICVFYDR

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

LLTETGKTIQQSVSVTVAIRINICVFYDRNYMLQ

Conservation Score

0.058

PhyloCSF Frame 1

-6.293

No. of Spectra

26

CPC Coding Probability

0.182239

PhyloCSF Frame 2 

-5.748

CNTI Index

noncoding

Max Probability

0.9429

PhyloCSF Frame 3

-5.367

CNTI Score

-0.373796826