McDonnell Genome Institute

Washington University

Transcript

LURAP1L-AS1:3

Chromosome

chr9

Gene Name

LURAP1L-AS1

Start

12797912

CPC Label

noncoding

End

12814377

Cancer

OV

Strand

-

Peptide

LSVMEEGK

Modified Peptide

n[145]LSVM[147]EEGK

Peptide Length

8

ORF Length

59

Open Reading Frame (ORF)

LLSFWRGLRKLSVMEEGKRRASISRGQSRRKRVGDVSHTFKDQISGELTNPMTASRRVM

Conservation Score

0.076

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0598288

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9789

PhyloCSF Frame 3

0

CNTI Score

-0.369593051