McDonnell Genome Institute

Washington University

Transcript

LUCAT1:3

Chromosome

chr5

Gene Name

LUCAT1

Start

91311020

CPC Label

noncoding

End

91314402

Cancer

OSCC

Strand

-

Peptide

MPRPPETMCQARIALDRCNLR

Modified Peptide

n[145]M[147]PRPPETMCQARIALDRCNLR

Peptide Length

21

ORF Length

36

Open Reading Frame (ORF)

MPRPPETMCQARIALDRCNLRTAFILFSLILSHYVF

Conservation Score

0.573

PhyloCSF Frame 1

-4.327

No. of Spectra

12

CPC Coding Probability

0.035304

PhyloCSF Frame 2 

-5.348

CNTI Index

noncoding

Max Probability

0.7549

PhyloCSF Frame 3

-4.277

CNTI Score

-0.339288339