McDonnell Genome Institute

Washington University

Transcript

LRRC75A-AS1:67

Chromosome

chr17

Gene Name

LRRC75A-AS1

Start

16439326

CPC Label

noncoding

End

16463986

Cancer

OV

Strand

+

Peptide

YLPHMILR

Modified Peptide

n[145]YLPHM[147]ILR

Peptide Length

8

ORF Length

108

Open Reading Frame (ORF)

LSFCLYSELLKYLPHMILRNPWKARRLDIIIYSLQMETPRPTPSVLLEFQEGWGWGTASALGMFCRLHCSYLPGGGERVAELDRWRAGTGSAVWQLTLIQAKKESLLG

Conservation Score

0.119

PhyloCSF Frame 1

-4.047

No. of Spectra

3

CPC Coding Probability

0.156464

PhyloCSF Frame 2 

-4.016

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-4.02

CNTI Score

-0.348553203