McDonnell Genome Institute

Washington University

Transcript

LRRC3-DT:11

Chromosome

chr21

Gene Name

LRRC3-DT

Start

44444828

CPC Label

noncoding

End

44455087

Cancer

BRCA-Luminal B

Strand

-

Peptide

SDSAVSGCPR

Modified Peptide

n[145]SDSAVSGCPR

Peptide Length

10

ORF Length

55

Open Reading Frame (ORF)

LRCFAGPQVFLRIPCVFPAWPLRSDSAVSGCPRVESDLPPASPVPASPVPAGQAH

Conservation Score

0.011

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.164077

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.320606921