McDonnell Genome Institute

Washington University

Transcript

LRRC3-DT:10

Chromosome

chr21

Gene Name

LRRC3-DT

Start

44443323

CPC Label

noncoding

End

44455087

Cancer

CCRC

Strand

-

Peptide

LEGGALK

Modified Peptide

LEGGALK

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

LEGGALKSLSPPTPPHPAGASSSWPQKAAGALAIVSAFSQLPLTLPPAPTQILLTVSSSLRGQ

Conservation Score

0.749

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.24737

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.292547844