McDonnell Genome Institute

Washington University

Transcript

LOXL1-AS1:24

Chromosome

chr15

Gene Name

LOXL1-AS1

Start

73907894

CPC Label

coding

End

73947224

Cancer

OV

Strand

-

Peptide

AWARMAGMLSHGAAKTLEMAK

Modified Peptide

n[145]AWARM[147]AGM[147]LSHGAAKTLEMAK

Peptide Length

21

ORF Length

148

Open Reading Frame (ORF)

LVGVGWGGSHHPKTGWMGLLRLPRKTLATINFLLPGGRQEPGVLPYCVIGLLCGLGLTQPHFRLHGLHSSTSNCPPPDSGPEALCRPLWAFFLRCRLHRAWARMAGMLSHGAAKTLEMAKARMLGWGGAACEGIRSQGHSFHRETASH

Conservation Score

0.919

PhyloCSF Frame 1

-3.318

No. of Spectra

1

CPC Coding Probability

0.856947

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5646

PhyloCSF Frame 3

0

CNTI Score

-0.258343284