McDonnell Genome Institute

Washington University

Transcript

LNCOC1:9

Chromosome

chr8

Gene Name

LNCOC1

Start

142688218

CPC Label

coding

End

142727000

Cancer

OV

Strand

-

Peptide

AYEEPGHIAGSEWQASK

Modified Peptide

n[145]AYEEPGHIAGSEWQASK

Peptide Length

17

ORF Length

36

Open Reading Frame (ORF)

MAYEEPGHIAGSEWQASKDSSLRSASCQMSSGIRFL

Conservation Score

0.783

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.723781

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.257870532