McDonnell Genome Institute

Washington University

Transcript

LNCOC1:8

Chromosome

chr8

Gene Name

LNCOC1

Start

142688218

CPC Label

coding

End

142727000

Cancer

LUAD

Strand

-

Peptide

VYHVDQSGLELLTSNDPSASASQSIGITGVSHST

Modified Peptide

n[230]VYHVDQSGLELLTSNDPSASASQSIGITGVSHST

Peptide Length

34

ORF Length

100

Open Reading Frame (ORF)

LIFFFNFFETESCSFTKAGVQWHDLGSLQPLPPRSKWFSCLSFPSSWDYRHEPPCLANFSIFSRDRVYHVDQSGLELLTSNDPSASASQSIGITGVSHST

Conservation Score

0.321

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.707914

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.257870532