McDonnell Genome Institute

Washington University

Transcript

LNCOC1:11

Chromosome

chr8

Gene Name

LNCOC1

Start

142714859

CPC Label

noncoding

End

142727000

Cancer

OV

Strand

-

Peptide

VGTWVTGAK

Modified Peptide

n[145]VGTWVTGAK

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

MVGTWVTGAKGPSRSVWATCLAASPAQLSPRLVKELPAGALHGA

Conservation Score

0.335

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.14887

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8971

PhyloCSF Frame 3

0

CNTI Score

-0.281206398