McDonnell Genome Institute

Washington University

Transcript

LNCARSR:11

Chromosome

chr9

Gene Name

LNCARSR

Start

79517886

CPC Label

noncoding

End

79567771

Cancer

EOGC

Strand

-

Peptide

ALATTSQK

Modified Peptide

n[145]ALATTSQK

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

MALATTSQKCVRAVEGALFFFLLQYKQSYLYHKA

Conservation Score

0.736

PhyloCSF Frame 1

-5.64

No. of Spectra

4

CPC Coding Probability

0.0520291

PhyloCSF Frame 2 

-6.174

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-6.187

CNTI Score

-0.365483326