top of page

McDonnell Genome Institute

Washington University

Transcript

LINC02593:35

Chromosome

chr1

Gene Name

LINC02593

Start

916864

CPC Label

coding

End

921016

Cancer

BRCA-Luminal B

Strand

-

Peptide

AAGGTQPLAQAGR

Modified Peptide

n[145]AAGGTQPLAQAGR

Peptide Length

13

ORF Length

74

Open Reading Frame (ORF)

MQSPRGRGKAAISGSLCSPGTWGPARAAGGTQPLAQAGRVPSRGPSLRHSPAHTCSTGTKTNKTPASRKTALSC

Conservation Score

1

PhyloCSF Frame 1

-4.818

No. of Spectra

4

CPC Coding Probability

0.54335

PhyloCSF Frame 2 

-1.956

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-4.045

CNTI Score

-0.288736886

bottom of page