top of page

McDonnell Genome Institute

Washington University

Transcript

LINC02565:8

Chromosome

chr18

Gene Name

LINC02565

Start

57165873

CPC Label

noncoding

End

57433581

Cancer

OV

Strand

-

Peptide

SNGPSSVLNLLGCEHK

Modified Peptide

n[145]SNGPSSVLNLLGCEHK

Peptide Length

16

ORF Length

49

Open Reading Frame (ORF)

LEIRSREEHEVRYLDAKSNGPSSVLNLLGCEHKWTFVITPSLKWVCLWI

Conservation Score

0.198

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0716204

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.316789575

bottom of page