top of page

McDonnell Genome Institute

Washington University

Transcript

LINC02424:3

Chromosome

chr12

Gene Name

LINC02424

Start

78326679

CPC Label

noncoding

End

78359746

Cancer

OV

Strand

-

Peptide

MEESFEPYPGLLK

Modified Peptide

n[145]MEESFEPYPGLLK

Peptide Length

13

ORF Length

43

Open Reading Frame (ORF)

MEESFEPYPGLLKMMRQKRKRKLLQTVLLRNLSQINFGVRSET

Conservation Score

1

PhyloCSF Frame 1

-4.912

No. of Spectra

2

CPC Coding Probability

0.0277118

PhyloCSF Frame 2 

-3.796

CNTI Index

noncoding

Max Probability

0.8107

PhyloCSF Frame 3

-4.972

CNTI Score

-0.38213544

bottom of page