top of page

McDonnell Genome Institute

Washington University

Transcript

LINC02199:10

Chromosome

chr5

Gene Name

LINC02199

Start

8839758

CPC Label

noncoding

End

8842460

Cancer

OV

Strand

+

Peptide

ALAGAGAARGAR

Modified Peptide

n[145]ALAGAGAARGAR

Peptide Length

12

ORF Length

93

Open Reading Frame (ORF)

LLALGASSASASALAALKELFSPPLRYEGLSLGLAEAGACSLCWRGGVKRKALAGAGAARGARGPALGFQVSSGSASPALGVAGRRLLGLIGD

Conservation Score

0.078

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.050083

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2251

PhyloCSF Frame 3

0

CNTI Score

-0.309466982

bottom of page