top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01902:15

Chromosome

chr18

Gene Name

LINC01902

Start

39841808

CPC Label

noncoding

End

39889993

Cancer

OSCC

Strand

+

Peptide

GSGSILWFLDAR

Modified Peptide

n[145]GSGSILWFLDAR

Peptide Length

12

ORF Length

33

Open Reading Frame (ORF)

MLGRLIKGSGSILWFLDARKAVEIKLHVAPHTH

Conservation Score

0.133

PhyloCSF Frame 1

-6.135

No. of Spectra

13

CPC Coding Probability

0.331237

PhyloCSF Frame 2 

-3.759

CNTI Index

noncoding

Max Probability

0.9064

PhyloCSF Frame 3

-6.126

CNTI Score

-0.378821077

bottom of page