top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01614:8

Chromosome

chr2

Gene Name

LINC01614

Start

215718042

CPC Label

noncoding

End

215719424

Cancer

BRCA-Luminal A

Strand

+

Peptide

GTSDTENLR

Modified Peptide

n[145]GTSDTENLR

Peptide Length

9

ORF Length

62

Open Reading Frame (ORF)

LETSMFLPPRIRKGTSDTENLRHQELRRMESQDIRQIPKRSEPSSKGQPFPKCQPRAKPREL

Conservation Score

1

PhyloCSF Frame 1

-5.683

No. of Spectra

3

CPC Coding Probability

0.0393998

PhyloCSF Frame 2 

-2.664

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

-5.09

CNTI Score

-0.434570281

bottom of page