top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01521:1

Chromosome

chr22

Gene Name

LINC01521

Start

31346758

CPC Label

noncoding

End

31351155

Cancer

OSCC

Strand

+

Peptide

LIVVFLVEMGFR

Modified Peptide

n[145]LIVVFLVEM[147]GFR

Peptide Length

12

ORF Length

149

Open Reading Frame (ORF)

LQNIFITPKENSVHVKKSLSIPFSLHPLATTNLHSVSMDLPILDIFFIYLFFETKSLSPRLECSGAILAHCNLYLLGSSGSLASVFQVAGITGACHRARLIVVFLVEMGFRHVGQTGLELLTSGDLSTSASQGAGITDVSHHAQPGYFI

Conservation Score

0.135

PhyloCSF Frame 1

0

No. of Spectra

120

CPC Coding Probability

0.261873

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

0.678471006

bottom of page