top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01366:6

Chromosome

chr5

Gene Name

LINC01366

Start

170331429

CPC Label

noncoding

End

170333710

Cancer

HCC

Strand

+

Peptide

AEGAASQK

Modified Peptide

n[230]AEGAASQK

Peptide Length

8

ORF Length

76

Open Reading Frame (ORF)

MCPGVMGVGSTQSIVLVPGFPKPSTMNVQWKAEGAASQKDASTHKDWSSQVSSITCKPEKPETLPLGHFINGDFIV

Conservation Score

0.11

PhyloCSF Frame 1

-2.746

No. of Spectra

10

CPC Coding Probability

0.359429

PhyloCSF Frame 2 

-3.95

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

-3.297

CNTI Score

-0.347411813

bottom of page