top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01301:2

Chromosome

chr8

Gene Name

LINC01301

Start

60384587

CPC Label

noncoding

End

60516780

Cancer

OV

Strand

-

Peptide

SYLTAALSSWAWHK

Modified Peptide

n[145]SYLTAALSSWAWHK

Peptide Length

14

ORF Length

39

Open Reading Frame (ORF)

MRSYLTAALSSWAWHKQFLNSWPQAILLPWPPKLLGLQA

Conservation Score

0.423

PhyloCSF Frame 1

0

No. of Spectra

71

CPC Coding Probability

0.0176547

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

0

CNTI Score

-0.376989254

bottom of page