top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01277:3

Chromosome

chr6

Gene Name

LINC01277

Start

142967071

CPC Label

noncoding

End

143039240

Cancer

PRAD

Strand

-

Peptide

KHQGGEGHVDSMNLR

Modified Peptide

Peptide Length

15

ORF Length

73

Open Reading Frame (ORF)

MCIGAKEVIMGKPCGGSRVPGVQGSMYRGYIWWQLYAQQKKHQGGEGHVDSMNLRCDVRKMAFYLCVLPPQNL

Conservation Score

0.315

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0598003

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8682

PhyloCSF Frame 3

0

CNTI Score

-0.316291446

bottom of page