top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01226:9

Chromosome

chr1

Gene Name

LINC01226

Start

31506280

CPC Label

noncoding

End

31541683

Cancer

OV

Strand

+

Peptide

LTYGSASCTR

Modified Peptide

n[145]LTYGSASCTR

Peptide Length

10

ORF Length

64

Open Reading Frame (ORF)

LTYGSASCTRSMVPTSASGEDSGSFHSWLKAKGKPASHGKRGSKTEEGVLQAPLNNQISYGLTE

Conservation Score

0.152

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.159975

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6353

PhyloCSF Frame 3

0

CNTI Score

0.676031072

bottom of page