top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01095:1

Chromosome

chr4

Gene Name

LINC01095

Start

146109456

CPC Label

noncoding

End

146121913

Cancer

LUAD

Strand

-

Peptide

AHSPVQPLPPSR

Modified Peptide

n[230]AHSPVQPLPPSR

Peptide Length

12

ORF Length

37

Open Reading Frame (ORF)

MAHSPVQPLPPSRHIKFKSHGPECIGTAPSPFSLWAS

Conservation Score

0.07

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0536617

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

0

CNTI Score

-0.34434841

bottom of page