top of page

McDonnell Genome Institute

Washington University

Transcript

LINC01093:22

Chromosome

chr4

Gene Name

LINC01093

Start

184889537

CPC Label

noncoding

End

184899329

Cancer

OSCC

Strand

-

Peptide

LRLGTSWMMPFFR

Modified Peptide

n[145]LRLGTSWMMPFFR

Peptide Length

13

ORF Length

76

Open Reading Frame (ORF)

LQHKRDSARKCFEASLKQGYHESRCRHSENILPSCLMIIYRKIRLRLGTSWMMPFFRNVATFKYFHVNIVHVLPRL

Conservation Score

0.642

PhyloCSF Frame 1

-4.837

No. of Spectra

46

CPC Coding Probability

0.0439349

PhyloCSF Frame 2 

-5.778

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-4.625

CNTI Score

-0.351761601

bottom of page