top of page

McDonnell Genome Institute

Washington University

Transcript

LINC00621:4

Chromosome

chr13

Gene Name

LINC00621

Start

22868798

CPC Label

coding

End

22915767

Cancer

EOGC

Strand

-

Peptide

LFPVPHAAEGGK

Modified Peptide

n[145]LFPVPHAAEGGK

Peptide Length

12

ORF Length

74

Open Reading Frame (ORF)

LLKLFPVPHAAEGGKRKERQAEVNRKSRIQLTEKKKTFLQKHVPRRQKNIKSFYIHTHTHTHTHTHGLRILSFN

Conservation Score

0.388

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

0.741447294

bottom of page