top of page

McDonnell Genome Institute

Washington University

Transcript

LINC00211:14

Chromosome

chr2

Gene Name

LINC00211

Start

37820464

CPC Label

noncoding

End

37829304

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

FNIEDDLER

Modified Peptide

n[145]FNIEDDLER

Peptide Length

9

ORF Length

107

Open Reading Frame (ORF)

LGYCSISLVLQVAETTPTFTTPKYAKPMARTQFPKCVTCTIFVTPFNTERIIKFNIEDDLERLYFSSSFQIELNSNTTSVIFSKYRSRSYPKDSILASQGGALSSVF

Conservation Score

1

PhyloCSF Frame 1

-4.399

No. of Spectra

1

CPC Coding Probability

0.106656

PhyloCSF Frame 2 

-3.803

CNTI Index

noncoding

Max Probability

0.0658

PhyloCSF Frame 3

-4.375

CNTI Score

-0.294091979

bottom of page