top of page

McDonnell Genome Institute

Washington University

Transcript

LEF1-AS1:24

Chromosome

chr4

Gene Name

LEF1-AS1

Start

108172695

CPC Label

noncoding

End

108180376

Cancer

OSCC

Strand

+

Peptide

ALICFYGREVLHKHTILTVTK

Modified Peptide

n[145]ALICFYGREVLHKHTILTVTK

Peptide Length

21

ORF Length

33

Open Reading Frame (ORF)

LFVERCTSKALICFYGREVLHKHTILTVTKNDP

Conservation Score

0.742

PhyloCSF Frame 1

-5.712

No. of Spectra

7

CPC Coding Probability

0.0729498

PhyloCSF Frame 2 

-5.062

CNTI Index

noncoding

Max Probability

0.8352

PhyloCSF Frame 3

-5.358

CNTI Score

-0.303252596

bottom of page