top of page

McDonnell Genome Institute

Washington University

Transcript

HLX-AS1:3

Chromosome

chr1

Gene Name

HLX-AS1

Start

220871313

CPC Label

noncoding

End

220880251

Cancer

EOGC

Strand

-

Peptide

ASLSPPGPRLECK

Modified Peptide

n[145]ASLSPPGPRLECK

Peptide Length

13

ORF Length

105

Open Reading Frame (ORF)

LPRFKARSAGQMRRKRGPEARRLLAAPRASLSPPGPRLECKLQLRLRAPCSPRPQLPRNRVGAIQGLTPSSRRQTRNTSLWSDPRRPLYPFPRPKPGPCRPLAEF

Conservation Score

0.563

PhyloCSF Frame 1

-1.556

No. of Spectra

26

CPC Coding Probability

0.287538

PhyloCSF Frame 2 

-1.377

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-0.095

CNTI Score

-0.266197674

bottom of page