top of page

McDonnell Genome Institute

Washington University

Transcript

GRM7-AS3:8

Chromosome

chr3

Gene Name

GRM7-AS3

Start

6740366

CPC Label

noncoding

End

6742687

Cancer

OV

Strand

-

Peptide

ETNMAVWFGK

Modified Peptide

n[145]ETNM[147]AVWFGK

Peptide Length

10

ORF Length

56

Open Reading Frame (ORF)

MKETNMAVWFGKAHLIVYEVTEESDSCLATHLFIWKEASMILAHGRNVPTHAYRNA

Conservation Score

0.101

PhyloCSF Frame 1

-5.028

No. of Spectra

13

CPC Coding Probability

0.0565768

PhyloCSF Frame 2 

-6.41

CNTI Index

noncoding

Max Probability

0.8343

PhyloCSF Frame 3

-6.321

CNTI Score

-0.396552937

bottom of page