top of page

McDonnell Genome Institute

Washington University

Transcript

FTX:19

Chromosome

chrX

Gene Name

FTX

Start

74209975

CPC Label

noncoding

End

74213660

Cancer

OV

Strand

-

Peptide

SELTALRSGGREGR

Modified Peptide

n[145]SELTALRSGGREGR

Peptide Length

14

ORF Length

52

Open Reading Frame (ORF)

LDLEAYMNEANLRSVIFVNEDRSELTALRSGGREGREKMRDAIKSITSMDLK

Conservation Score

0.137

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0499015

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6516

PhyloCSF Frame 3

0

CNTI Score

-0.437266082

bottom of page