top of page

McDonnell Genome Institute

Washington University

Transcript

FMR1-AS1:15

Chromosome

chrX

Gene Name

FMR1-AS1

Start

147887971

CPC Label

noncoding

End

147911784

Cancer

EOGC

Strand

-

Peptide

EAEINER

Modified Peptide

n[145]EAEINER

Peptide Length

7

ORF Length

112

Open Reading Frame (ORF)

LEKQRCELSDRKFRIAVLKKLKEIQHNTEKKFRIVSDKCNKEAEINERNQAEILDLKNAVDILKNALDSLNSRIDKAEEIISDLEDRLFESTQSQDTEKNKKQGSMPTGYRK

Conservation Score

0.84

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.153727

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9775

PhyloCSF Frame 3

0

CNTI Score

0.656086771

bottom of page