top of page

McDonnell Genome Institute

Washington University

Transcript

EVX1-AS:5

Chromosome

chr7

Gene Name

EVX1-AS

Start

27239242

CPC Label

noncoding

End

27241228

Cancer

EOGC

Strand

-

Peptide

ESEAGHRPPDAR

Modified Peptide

n[145]ESEAGHRPPDAR

Peptide Length

12

ORF Length

103

Open Reading Frame (ORF)

MESEAGHRPPDARVSWNSFAPEENRARKSGACGACLRSLPARLGGDGPRPRSPSPACSGPFNGDRAPRRERARSPEPGARSWLVGSGVGENVIRKKMFSLLFG

Conservation Score

0.981

PhyloCSF Frame 1

0.388

No. of Spectra

9

CPC Coding Probability

0.214661

PhyloCSF Frame 2 

-4.196

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0.147

CNTI Score

-0.296924892

bottom of page