top of page

McDonnell Genome Institute

Washington University

Transcript

ELN-AS1:6

Chromosome

chr7

Gene Name

ELN-AS1

Start

74059575

CPC Label

noncoding

End

74062284

Cancer

BRCA-Basal-like

Strand

-

Peptide

LIINQDLIK

Modified Peptide

n[145]LIINQDLIK

Peptide Length

9

ORF Length

47

Open Reading Frame (ORF)

LIINQDLIKEDRSLWKEGWSLGPGIDLLCDPGSVTFPCWASASSSLI

Conservation Score

0.025

PhyloCSF Frame 1

-4.197

No. of Spectra

1

CPC Coding Probability

0.0454739

PhyloCSF Frame 2 

-4.15

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-4.195

CNTI Score

-0.260651627

bottom of page