top of page

McDonnell Genome Institute

Washington University

Transcript

CNTN4-AS1:1

Chromosome

chr3

Gene Name

CNTN4-AS1

Start

3042841

CPC Label

noncoding

End

3069242

Cancer

OV

Strand

-

Peptide

TSSSIFFFVFMSPIFNLR

Modified Peptide

n[145]TSSSIFFFVFM[147]SPIFNLR

Peptide Length

18

ORF Length

54

Open Reading Frame (ORF)

LGGGAHGALSKTSSIQLDSTNPGPHLPDDEANWSKTSSSIFFFVFMSPIFNLRR

Conservation Score

1

PhyloCSF Frame 1

-0.377

No. of Spectra

3

CPC Coding Probability

0.0150101

PhyloCSF Frame 2 

9.131

CNTI Index

noncoding

Max Probability

0.8135

PhyloCSF Frame 3

-4.176

CNTI Score

-0.305097471

bottom of page