top of page

McDonnell Genome Institute

Washington University

Transcript

CA3-AS1:13

Chromosome

chr8

Gene Name

CA3-AS1

Start

85440608

CPC Label

noncoding

End

85463820

Cancer

OSCC

Strand

-

Peptide

GSVSGVPGLGLASWVRSYDLGANR

Modified Peptide

n[145]GSVSGVPGLGLASWVRSYDLGANR

Peptide Length

24

ORF Length

121

Open Reading Frame (ORF)

LGWQRSSELWACGGCGGSWAPPSNPGRGASTRTPSPSRLRSLAAAGTARDPDPRRLSSPVPIVTCLLAPEPSRPTRAGVSSAKGSVSGVPGLGLASWVRSYDLGANRDTILEAQGSAQHEC

Conservation Score

1

PhyloCSF Frame 1

-2.085

No. of Spectra

5

CPC Coding Probability

0.059595

PhyloCSF Frame 2 

-1.59

CNTI Index

noncoding

Max Probability

0.8893

PhyloCSF Frame 3

-1.927

CNTI Score

-0.310609887

bottom of page