top of page

McDonnell Genome Institute

Washington University

Transcript

AIRN:2

Chromosome

chr6

Gene Name

AIRN

Start

160003290

CPC Label

noncoding

End

160007664

Cancer

OSCC

Strand

-

Peptide

TTLDQAVSSFMYK

Modified Peptide

n[145]TTLDQAVSSFMYK

Peptide Length

13

ORF Length

136

Open Reading Frame (ORF)

LAATASLAGRAGRGAHPLLAGFLAAQWPRATPARGRREPRPPRQGPGRDCGLPPPRQAPSQLPRPVPNMPGLGLPALQTPSSRFTRLPAGTPKTRRQSLLRTTLDQAVSSFMYKAVRCFSAAMAPSSTSCHRSLHR

Conservation Score

0.938

PhyloCSF Frame 1

0.076

No. of Spectra

12

CPC Coding Probability

0.113365

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9942

PhyloCSF Frame 3

0

CNTI Score

-0.253248385

bottom of page