top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|41205302|41225137|+|USP9X|ENST00000324545.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.92

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

LANSQSNVDPR

Amino Acids from 5' Exons

SNVDPRDDVFGYPQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQF,AMLIPGMMYLDILNNLKINQHVKLKIEKSTTLVSDTFRSSLVILLLDCNTMCPEDFGNSS,QCSQGCIWISSTIRTSIKNRKRVQHWCPKTPSGHLWSFSCFSTAILCAQRILETVQ

Amino Acids from 3' Exons

VAYSYTYELRPYLDLLLQILLIEDSWQTH,LHIPIPMNCGPIWICFCKSYLRTPGKLT,CIFLYLTAALFGSAFANLTDGLLANSQ

bottom of page