top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|154439940|154441794|+|GDI1|ENST00000491154.1

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9055

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

GAVELVPVSPGR

Amino Acids from 5' Exons

IWACLRNGASASSWCLWQTSMRMTPRPLRALTPRLPACVTSTGSLIWARMSSISLAMPWRSTALMSEGKLGGGSPLARPAPTLPTPACCPPAPHVSCTQPQAHLSPFPFPPCISSSSPGHSGWWEDWPGTWVGVNQGCCYSPSYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARGHGFFQLALSRTRARSGDGRLEHFLGSISSFPIRALHLLHSILGGHNPSALKYRSLHTKNESPQMLAQFPAAPGLGPGSQNLESGLSWELTYLQRVHSGPSGCLGAEHSLMPPPAGPWQCILSRSSREERARGDGASVHGSDRAGMNPGVSYLLPAWGSLLCTLVEEGCSGIGPRFSWEGPSPELLSPQIECHLWGDIYAEQTCGHHHGERQGGGREVGRGEPFPCMQCSPMVEAGLGHFLCAVESPAAQPQGSWSWELGVQKSSESLWVRGLFQRPHAMSVVQKVFLITVPLGGGGAGTQPVRQGPPIAAGGHAFRRGSSDGSEERLVCQSCLPLLAQPHVYLREGCDRGEDFWCLLRWPAASSSVTPATSRTVCGRLARLSASSVSLATPSRTPTTPTPAKSSPRTRSTGSQ,SDGHVETALPQVPGVCGKLREPQDLGRPPDYQHARLPEVSGPGCHRFHWPCPGALPHVRGSWVVAAPSPGPPPPFPHLPAVPLPRMSLVLSHRLTYHPFHFPLAFDPHLPQAIQGGGKTGLVPGWGIRGAAIPPATWTSPALRPSTASSCTVSPWPGMARAHIYTRSTAWASCPRVLQGEDMGFFSWHSVGLGPGVEMAALSIFLVVFPPFQFVLFIYFTPSLGDEGTTPVHSTEVSTLEKTSLHKCDLLSSRQHQDWAQGPRTLSQGLAGSPISRESILVPQAVLVRSTDPSCPLPLALGSVFAEAPERKEPAEMGPAFTAVTELGIPASPTCCLPGAAFFALWWRKGAVELVPVSPGRGLHRSCSHHRLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVSPSRACSAVPWLRRGLVTFSVLSSLLLHSPKGLGAGNWGSRSLQSHDCGEVSFRGHMPCLWCRKCSSQCLWGAGGRAPSPCVKAHLSERQGRAMHSGGAVVMAPRNVLSARAACPCCERSPTSTGRDVTGARTSGAFSGGPLQAADLPQLHPGPCAEGWPGYPHHLYPPPHQEHQRRQLLPNNHPPEPGQQEV,LMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDEGEAGWWQPPRPARPHPSHTCLLSPCPACLLYSATGSPITLSISPLHLILIFPRPFRVVGRLAWYLGGGKSGVLLFPQLPGPALPDRQPHQVVQVPGPVWQEPIFIPALRLGRAAPGFCKVRTWVFSVGIAEDGQEWRWPPAFSWYFLLSNSCSSFTSLHPWVMRAQPQCTEVQKSPHLKKRVSTNVTCSVPGSTRTGPRVPEPVRALGADLSPESPFWSLRLSWCGALIPHAPSRWPLAVYSEQKLQRGKSPRRWGQRSRQQSWDESRRLLPAACLGQPSLHFGGGRVQWNWSPFLLGGAFTGAALTTDVPSMGGHICTNLWMTSSWRTARWWASLRERALPVHAVQSHGGGAWSLSLCCRVSCCTAPRVLELGTGGPEVFRVMTVGERSLSEATCHVCGAESVLDHSASGGRGGGHPARASRPTYLSGRVGPCIQEGQWLRGTSCLPELPALAVSAAPRLPKGGMQGRGLLVPSQVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKS

Amino Acids from 3' Exons

IWACLRNGASASSWCLWQTSMRMTPRPLRALTPRLPACVTSTGSLIWARMSSISLAMPWRSTALMSEGKLGGGSPLARPAPTLPTPACCPPAPHVSCTQPQAHLSPFPFPPCISSSSPGHSGWWEDWPGTWVGVNQGCCYSPSYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARGHGFFQLALSRTRARSGDGRLEHFLGSISSFPIRALHLLHSILGGHNPSALKYRSLHTKNESPQMLAQFPAAPGLGPGSQNLESGLSWELTYLQRVHSGPSGCLGAEHSLMPPPAGPWQCILSRSSREERARGDGASVHGSDRAGMNPGVSYLLPAWGSLLCTLVEEGCSGIGPRFSWEGPSPELLSPQIECHLWGDIYAEQTCGHHHGERQGGGREVGRGEPFPCMQCSPMVEAGLGHFLCAVESPAAQPQGSWSWELGVQKSSESLWVRGLFQRPHAMSVVQKVFLITVPLGGGGAGTQPVRQGPPIAAGGHAFRRGSSDGSEERLVCQSCLPLLAQPHVYLREGCDRGEDFWCLLRWPAASSSVTPATSRTVCGRLARLSASSVSLATPSRTPTTPTPAKSSPRTRSTGSQ,SDGHVETALPQVPGVCGKLREPQDLGRPPDYQHARLPEVSGPGCHRFHWPCPGALPHVRGSWVVAAPSPGPPPPFPHLPAVPLPRMSLVLSHRLTYHPFHFPLAFDPHLPQAIQGGGKTGLVPGWGIRGAAIPPATWTSPALRPSTASSCTVSPWPGMARAHIYTRSTAWASCPRVLQGEDMGFFSWHSVGLGPGVEMAALSIFLVVFPPFQFVLFIYFTPSLGDEGTTPVHSTEVSTLEKTSLHKCDLLSSRQHQDWAQGPRTLSQGLAGSPISRESILVPQAVLVRSTDPSCPLPLALGSVFAEAPERKEPAEMGPAFTAVTELGIPASPTCCLPGAAFFALWWRKGAVELVPVSPGRGLHRSCSHHRLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVSPSRACSAVPWLRRGLVTFSVLSSLLLHSPKGLGAGNWGSRSLQSHDCGEVSFRGHMPCLWCRKCSSQCLWGAGGRAPSPCVKAHLSERQGRAMHSGGAVVMAPRNVLSARAACPCCERSPTSTGRDVTGARTSGAFSGGPLQAADLPQLHPGPCAEGWPGYPHHLYPPPHQEHQRRQLLPNNHPPEPGQQEV,LMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDEGEAGWWQPPRPARPHPSHTCLLSPCPACLLYSATGSPITLSISPLHLILIFPRPFRVVGRLAWYLGGGKSGVLLFPQLPGPALPDRQPHQVVQVPGPVWQEPIFIPALRLGRAAPGFCKVRTWVFSVGIAEDGQEWRWPPAFSWYFLLSNSCSSFTSLHPWVMRAQPQCTEVQKSPHLKKRVSTNVTCSVPGSTRTGPRVPEPVRALGADLSPESPFWSLRLSWCGALIPHAPSRWPLAVYSEQKLQRGKSPRRWGQRSRQQSWDESRRLLPAACLGQPSLHFGGGRVQWNWSPFLLGGAFTGAALTTDVPSMGGHICTNLWMTSSWRTARWWASLRERALPVHAVQSHGGGAWSLSLCCRVSCCTAPRVLELGTGGPEVFRVMTVGERSLSEATCHVCGAESVLDHSASGGRGGGHPARASRPTYLSGRVGPCIQEGQWLRGTSCLPELPALAVSAAPRLPKGGMQGRGLLVPSQVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKS

bottom of page