top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|154439940|154440506|+|GDI1|ENST00000447750.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9867

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

VLQDLMGMFEK

Amino Acids from 5' Exons

IWACLRNGASASSWCLWQTSMRMTPRPLRALTPRLPACVTSTGSLIWARMSSISLAMPWRSTALM,SDGHVETALPQVPGVCGKLREPQDLGRPPDYQHARLPEVSGPGCHRFHWPCPGALPH,LMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTD

Amino Acids from 3' Exons

LPGPALPDRQPHQVVQVPGPVWQEPIFIPALRLGRAAPGFCK,YLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFA,TWTSPALRPSTASSCTVSPWPGMARAHIYTRSTAWASCPRVLQ

bottom of page